PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG033824t1
Common NameTCM_033824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 437aa    MW: 46568.4 Da    PI: 10.036
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG033824t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51.1e-16358411558
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+ eN++L+k+ ee+ ++ ++
  Thecc1EG033824t1 358 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKDENQELRKKHEEIMEMQKN 411
                       79**********************************************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-14354420IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.473356407IPR004827Basic-leucine zipper domain
PfamPF001701.6E-14358410IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-15358407No hitNo description
SuperFamilySSF579592.13E-11358407No hitNo description
CDDcd147071.39E-28358412No hitNo description
PROSITE patternPS000360361376IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MGTNMNFKNV GINPPPLADG GGNKPQPPGN IQLIRQPSIY SLTFDEFQST IGGIGKDFGS  60
MNMDELLKNI WSAEETQTMA SSSGGLEGNG GLQRQGSLTL PRTLSQKTVD EVWKDIAKEY  120
SIGKDGIGTG GTNNMPQRQQ TLGEMTLEEF LVRAGVVRED TPLVGKVNNG GFFGELPPSG  180
TNTGFGMGFQ HGGRGANLMG NRISESGNQI GIQASNLPLN VNGVRSNQHQ LAQQQQQHQQ  240
YQQPIFPKQP AVGYGAQIPL QSGGQLGSPG VRGGIAGIGD QGLSNGLIQG GAVQGGGMGM  300
VGLGGPVSVA TGSPANQLSS DGIGKSSGDT SSVSPAPYVF NGSLRGRKCS AVEKVVERRQ  360
RRMIKNRESA ARSRARKQAY TMELEAEVAK LKDENQELRK KHEEIMEMQK NQVMETMNMQ  420
QGAKKRCLRR TQTGPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017213.10.0Abscisic acid responsive elements-binding factor 2 isoform 1
RefseqXP_007017214.10.0Abscisic acid responsive elements-binding factor 2 isoform 1
SwissprotQ9M7Q41e-139AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A061FIW70.0A0A061FIW7_THECC; Abscisic acid responsive elements-binding factor 2 isoform 1
STRINGPOPTR_0002s12710.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-127abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]